PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g006560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 24349 Da    PI: 6.1588
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g006560.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.12e-271059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      rien + rqvtfskRr g+lKKA+ELSvLCda+v ++ifs+++klye+s+
  Sopen10g006560.1 10 RIENATSRQVTFSKRRYGLLKKAFELSVLCDAQVGLVIFSPRDKLYEFST 59
                      8***********************************************96 PP

2K-box73.65.6e-2582171897
             K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                       + e++++ +l+++ + L k+ie L++++R+llGe+Les+sl+eLqq+e+qLe s++ iR++K+e+++eqie+l++  k+l +en +L +k
  Sopen10g006560.1  82 AMEQNNMHNLKHDTSSLMKKIELLEKSKRKLLGESLESCSLEELQQMEHQLEWSINIIRARKMEVFREQIERLKENVKDLASENVMLLEK 171
                       478999********************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.011161IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-37160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-31374IPR002100Transcription factor, MADS-box
CDDcd002654.19E-40375No hitNo description
PfamPF003197.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-273859IPR002100Transcription factor, MADS-box
PfamPF014864.7E-2583172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.73288181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MVRGKTEMRR IENATSRQVT FSKRRYGLLK KAFELSVLCD AQVGLVIFSP RDKLYEFSTS  60
SMQEIIERYQ RHTKDIQCEN PAMEQNNMHN LKHDTSSLMK KIELLEKSKR KLLGESLESC  120
SLEELQQMEH QLEWSINIIR ARKMEVFREQ IERLKENVKD LASENVMLLE KCGGFEMQQT  180
SGGEDVSIVI SSEKSDVETE LLIGLPMSLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D5e-18372271Myocyte-specific enhancer factor 2A
3mu6_C5e-18372271Myocyte-specific enhancer factor 2A
3mu6_B5e-18372271Myocyte-specific enhancer factor 2A
3mu6_A5e-18372271Myocyte-specific enhancer factor 2A
3p57_J6e-18372271Myocyte-specific enhancer factor 2A
3p57_I6e-18372271Myocyte-specific enhancer factor 2A
3p57_D6e-18372271Myocyte-specific enhancer factor 2A
3p57_C6e-18372271Myocyte-specific enhancer factor 2A
3p57_B6e-18372271Myocyte-specific enhancer factor 2A
3p57_A6e-18372271Myocyte-specific enhancer factor 2A
3kov_J6e-18372271Myocyte-specific enhancer factor 2A
3kov_I6e-18372271Myocyte-specific enhancer factor 2A
3kov_B6e-18372271Myocyte-specific enhancer factor 2A
3kov_A6e-18372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015055385.11e-153PREDICTED: MADS-box protein SOC1-like
SwissprotO646451e-78SOC1_ARATH; MADS-box protein SOC1
TrEMBLM1AND51e-139M1AND5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000265761e-138(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.16e-64AGAMOUS-like 20